/*
* GeneticCode.java
*
* Copyright (C) 2002-2006 Alexei Drummond and Andrew Rambaut
*
* This file is part of BEAST.
* See the NOTICE file distributed with this work for additional
* information regarding copyright ownership and licensing.
*
* BEAST is free software; you can redistribute it and/or modify
* it under the terms of the GNU Lesser General Public License as
* published by the Free Software Foundation; either version 2
* of the License, or (at your option) any later version.
*
* BEAST is distributed in the hope that it will be useful,
* but WITHOUT ANY WARRANTY; without even the implied warranty of
* MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
* GNU Lesser General Public License for more details.
*
* You should have received a copy of the GNU Lesser General Public
* License along with BEAST; if not, write to the
* Free Software Foundation, Inc., 51 Franklin St, Fifth Floor,
* Boston, MA 02110-1301 USA
*/
package dr.evolution.datatype;
/**
* A set of standard genetic codes.
*
* @author Andrew Rambaut
* @author Alexei Drummond
*
* @version $Id: GeneticCode.java,v 1.11 2005/05/24 20:25:56 rambaut Exp $
*/
public final class GeneticCode implements CodonTable {
public static final String GENETIC_CODE = "geneticCode";
/**
* Constants used to refer to the built in code tables
*/
public static final int UNIVERSAL_ID = 0;
public static final int VERTEBRATE_MT_ID = 1;
public static final int YEAST_ID = 2;
public static final int MOLD_PROTOZOAN_MT_ID = 3;
public static final int MYCOPLASMA_ID = 4;
public static final int INVERTEBRATE_MT_ID = 5;
public static final int CILIATE_ID = 6;
public static final int ECHINODERM_MT_ID = 7;
public static final int EUPLOTID_NUC_ID = 8;
public static final int BACTERIAL_ID = 9;
public static final int ALT_YEAST_ID = 10;
public static final int ASCIDIAN_MT_ID = 11;
public static final int FLATWORM_MT_ID = 12;
public static final int BLEPHARISMA_NUC_ID = 13;
public static final int NO_STOPS_ID = 14;
/**
* Standard genetic code tables from GENBANK
* Nucleotides go A, C, G, T - Note: this is not the order used by the Genbank web site
* With the first codon position most significant (i.e. AAA, AAC, AAG, AAT, ACA, etc.).
*/
public static final String[] GENETIC_CODE_TABLES = {
// Universal
"KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSS*CWCLFLF",
// Vertebrate Mitochondrial
"KNKNTTTT*S*SMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF",
// Yeast
"KNKNTTTTRSRSMIMIQHQHPPPPRRRRTTTTEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF",
// Mold Protozoan Mitochondrial
"KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF",
// Mycoplasma
"KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF",
// Invertebrate Mitochondrial
"KNKNTTTTSSSSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF",
// Ciliate
"KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVVQYQYSSSS*CWCLFLF",
// Echinoderm Mitochondrial
"NNKNTTTTSSSSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF",
// Euplotid Nuclear
"KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSCCWCLFLF",
// Bacterial
"KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSS*CWCLFLF",
// Alternative Yeast
"KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLSLEDEDAAAAGGGGVVVV*Y*YSSSS*CWCLFLF",
// Ascidian Mitochondrial
"KNKNTTTTGSGSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF",
// Flatworm Mitochondrial
"NNKNTTTTSSSSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVVYY*YSSSSWCWCLFLF",
// Blepharisma Nuclear
"KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YQYSSSS*CWCLFLF",
// No stops
"KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVVYYQYSSSSWCWCLFLF"
};
/**
* Names of the standard genetic code tables from GENBANK
*/
public static final String[] GENETIC_CODE_NAMES = {
"universal", "vertebrateMitochondrial", "yeast", "moldProtozoanMitochondrial",
"mycoplasma", "invertebrateMitochondrial", "ciliate", "echinodermMitochondrial",
"euplotidNuclear", "bacterial", "alternativeYeast", "ascidianMitochondrial",
"flatwormMitochondrial", "blepharismaNuclear", "noStops"
};
/**
* Descriptions of the standard genetic code tables from GENBANK
*/
public static final String[] GENETIC_CODE_DESCRIPTIONS = {
"Universal", "Vertebrate Mitochondrial", "Yeast", "Mold Protozoan Mitochondrial",
"Mycoplasma", "Invertebrate Mitochondrial", "Ciliate", "Echinoderm Mitochondrial",
"Euplotid Nuclear", "Bacterial", "Alternative Yeast", "Ascidian Mitochondrial",
"Flatworm Mitochondrial", "Blepharisma Nuclear", "Test case with no stop codons"
};
public static final GeneticCode UNIVERSAL = new GeneticCode(UNIVERSAL_ID);
public static final GeneticCode VERTEBRATE_MT = new GeneticCode(VERTEBRATE_MT_ID);
public static final GeneticCode YEAST = new GeneticCode(YEAST_ID);
public static final GeneticCode MOLD_PROTOZOAN_MT = new GeneticCode(MOLD_PROTOZOAN_MT_ID);
public static final GeneticCode MYCOPLASMA = new GeneticCode(MYCOPLASMA_ID);
public static final GeneticCode INVERTEBRATE_MT = new GeneticCode(INVERTEBRATE_MT_ID);
public static final GeneticCode CILIATE = new GeneticCode(CILIATE_ID);
public static final GeneticCode ECHINODERM_MT = new GeneticCode(ECHINODERM_MT_ID);
public static final GeneticCode EUPLOTID_NUC = new GeneticCode(EUPLOTID_NUC_ID);
public static final GeneticCode BACTERIAL = new GeneticCode(BACTERIAL_ID);
public static final GeneticCode ALT_YEAST = new GeneticCode(ALT_YEAST_ID);
public static final GeneticCode ASCIDIAN_MT = new GeneticCode(ASCIDIAN_MT_ID);
public static final GeneticCode FLATWORM_MT = new GeneticCode(FLATWORM_MT_ID);
public static final GeneticCode BLEPHARISMA_NUC = new GeneticCode(BLEPHARISMA_NUC_ID);
public static final GeneticCode NO_STOPS = new GeneticCode(NO_STOPS_ID);
public static final GeneticCode[] GENETIC_CODES = {
UNIVERSAL, VERTEBRATE_MT, YEAST, MOLD_PROTOZOAN_MT, MYCOPLASMA, INVERTEBRATE_MT,
CILIATE, ECHINODERM_MT, EUPLOTID_NUC, BACTERIAL, ALT_YEAST, ASCIDIAN_MT,
FLATWORM_MT, BLEPHARISMA_NUC, NO_STOPS
};
public GeneticCode(int geneticCode) {
this.geneticCode = geneticCode;
codeTable = GENETIC_CODE_TABLES[geneticCode];
}
/**
* Returns the name of the genetic code
*/
public String getName() {
return GENETIC_CODE_NAMES[geneticCode];
}
/**
* Returns the description of the genetic code
*/
public String getDescription() {
return GENETIC_CODE_DESCRIPTIONS[geneticCode];
}
/**
* Returns the char associated with AminoAcid represented by codonState.
* Note that the char is as defined by AminoAcids.java
* @see AminoAcids
* @see Codons
* @return state for '?' if codon unknown
*/
public char getAminoAcidChar(int codonState) {
if (codonState == Codons.UNKNOWN_STATE)
return AminoAcids.UNKNOWN_CHARACTER;
else if (codonState == Codons.GAP_STATE)
return AminoAcids.GAP_CHARACTER;
return codeTable.charAt(codonState);
}
/**
* Returns the state associated with AminoAcid represented by codonState.
* Note that the state is the canonical state (generated combinatorially)
* @see AminoAcids
* @see Codons
* @return '?' if codon unknown
*/
public int getAminoAcidState(int codonState) {
if (codonState == Codons.UNKNOWN_STATE)
return AminoAcids.UNKNOWN_STATE;
else if (codonState == Codons.GAP_STATE)
return AminoAcids.GAP_STATE;
return AminoAcids.AMINOACID_STATES[getAminoAcidChar(codonState)];
}
/**
* Note that the state is the canonical state (generated combinatorially)
* @return whether the codonState is a stop codon
*/
public boolean isStopCodon(int codonState) {
return (getAminoAcidState(codonState) == AminoAcids.STOP_STATE);
}
/**
* @return all the possible codons for a given amino acid
*/
public char[][] getCodonsFromAminoAcidState(int aminoAcidState) {
throw new RuntimeException("not yet implemented");
}
/*
* @return all the possible codons for a given amino acid
*/
public char[][] getCodonsFromAminoAcidChar(char aminoAcidChar) {
throw new RuntimeException("not yet implemented");
}
/*
* @returns three IUPAC states representing the given amino acid
* @note The returned array should not be altered, and implementations
* should attempt to implement this as efficiently as possible
*/
public int[] getAmbiguousCodonFromAminoAcidState(int aminoAcid) {
throw new RuntimeException("not yet implemented");
}
/**
* @return the codon states of stop amino acids.
*/
public int[] getStopCodonIndices() {
int i, j, n = getStopCodonCount();
int[] indices = new int[n];
j = 0;
for (i = 0; i < 64; i++) {
if (codeTable.charAt(i) == AminoAcids.STOP_CHARACTER) {
indices[j] = i;
j++;
}
}
return indices;
}
/**
* Returns the number of terminator amino acids.
*/
public int getStopCodonCount() {
int i, count = 0;
for (i = 0; i < 64; i++) {
if (codeTable.charAt(i) == AminoAcids.STOP_CHARACTER)
count++;
}
return count;
}
private int geneticCode;
private String codeTable;
}