package com.compomics.util.test.protein; import com.compomics.util.junit.TestCaseLM; import com.compomics.util.protein.Enzyme; import com.compomics.util.protein.Protein; import com.compomics.util.protein.RegExEnzyme; import junit.framework.Assert; import junit.framework.TestCase; import org.apache.log4j.Logger; import java.io.*; /** * @author Florian Reisinger * @since 2.9 */ public class TestRegExEnzyme extends TestCase { // Class specific log4j logger for TestRegExEnzyme instances. Logger logger = Logger.getLogger(TestRegExEnzyme.class); private static final boolean recordResult = false; private static final String resultFileName = "regExEmzymeTest1.fas"; public TestRegExEnzyme() { this("Test scenario for the RegExEnzyme class."); } public TestRegExEnzyme(String s) { super(s); } /** * This method test the creation, setters and getters of an RegExEnzyme instance. * (Same tests as for Enzyme class! only slightly modified to fit RegExEnzyme) */ public void testCreation() { // First the two standard constructors with meaningfull data. // Also test the different setters. final String title1 = "Title1"; final String cleavage1 = "[ARNDCQ]"; final String restrict1 = "PG"; final char[] cv1 = cleavage1.toCharArray(); final char[] rs1 = restrict1.toCharArray(); final String pos1 = "Cterm"; final String pos2 = "nteRm"; final int miscleavage = 3; RegExEnzyme e = new RegExEnzyme(title1, cleavage1, restrict1, pos1); Assert.assertEquals(title1, e.getTitle()); Assert.assertEquals(new String(cv1), new String(e.getCleavage())); Assert.assertEquals(new String(rs1), new String(e.getRestrict())); Assert.assertEquals(RegExEnzyme.CTERM, e.getPosition()); Assert.assertEquals(1, e.getMiscleavages()); final String otherTitle = "other"; final String otherCleavage = "[HIK]"; final String otherRestrict = "MN"; final char[] otherCv = otherCleavage.toCharArray(); final char[] otherRs = otherRestrict.toCharArray(); e.setTitle(otherTitle); e.setCleavage(otherCleavage); e.setRestrict(otherRestrict); e.setPosition(RegExEnzyme.NTERM); e.setMiscleavages(miscleavage); Assert.assertEquals(otherTitle, e.getTitle()); Assert.assertEquals(new String(otherCv), new String(e.getCleavage())); Assert.assertEquals(new String(otherRs), new String(e.getRestrict())); Assert.assertEquals(RegExEnzyme.NTERM, e.getPosition()); Assert.assertEquals(miscleavage, e.getMiscleavages()); e.setCleavage(cleavage1); e.setRestrict(rs1); Assert.assertEquals(new String(cv1), new String(e.getCleavage())); Assert.assertEquals(new String(rs1), new String(e.getRestrict())); e = new RegExEnzyme(null, cleavage1, null, pos2, 5); Assert.assertTrue(e.getTitle() == null); Assert.assertEquals(new String(cv1), new String(e.getCleavage())); Assert.assertTrue(e.getRestrict() == null); Assert.assertEquals(RegExEnzyme.NTERM, e.getPosition()); Assert.assertEquals(5, e.getMiscleavages()); try { e = new RegExEnzyme(title1, null, restrict1, null); fail("No NullPointerException thrown when Enzyme constructor was presented with a 'null' cleavage and position String!"); } catch(NullPointerException npe) { // Okay, this is what we wanted. } try { e = new RegExEnzyme(title1, cleavage1, restrict1, null); fail("No NullPointerException thrown when Enzyme constructor was presented with a 'null' position String!"); } catch(NullPointerException npe) { // Okay, this is what we wanted. } } /** * This method test the cleaving behaviour of the RegExEnzyme class. * (Same tests as for Enzyme class! only slightly modified to fit RegExEnzyme) */ public void testCleave() { final String inputFile = "testCleave.fas"; final String input = TestCaseLM.getFullFilePath(inputFile).replace("%20", " "); try { // We need to obtain a pointer the control file before anything else. BufferedReader br = new BufferedReader(new FileReader(input)); // First one with zero MC's. RegExEnzyme e = new RegExEnzyme("TestEnzyme", "[KR]", "P", "Cterm", 0); Protein p = new Protein(">sw|Q55645|TEST_HUMAN Test Protein for the cleave() method.", "GHIKLMVSTRPIGASDNPKLHGFVNRTGFDA"); Protein[] result = e.cleave(p); if (recordResult) { // if there is a old file, delete it File resultFile = new File(resultFileName); if (resultFile.exists()) { resultFile.delete(); } writeResults(result, resultFileName); } boolean once = false; for(int i = 0; i < result.length; i++) { once = true; Protein lProtein = result[i]; String header = lProtein.getHeader().getFullHeaderWithAddenda(); String sequence = lProtein.getSequence().getSequence(); Assert.assertEquals(br.readLine(), header); Assert.assertEquals(br.readLine(), sequence); } if(!once) { fail("NO peptides AT ALL were returned when cleaving '" + p.getSequence().getSequence() + "'!"); } // Skip to the next part of the controlfile. br.readLine(); // 1 once = false; // Now with one miscleavage. e.setMiscleavages(1); result = e.cleave(p); if (recordResult) { writeResults(result, resultFileName); } for(int i = 0; i < result.length; i++) { once = true; Protein lProtein = result[i]; String header = lProtein.getHeader().getFullHeaderWithAddenda(); String sequence = lProtein.getSequence().getSequence(); Assert.assertEquals(br.readLine(), header); Assert.assertEquals(br.readLine(), sequence); } if(!once) { fail("NO peptides AT ALL were returned when cleaving '" + p.getSequence().getSequence() + "'!"); } // Skip to the next part of the controlfile. br.readLine(); // 2 once = false; // Now with three miscleavages. e.setMiscleavages(3); result = e.cleave(p); if (recordResult) { writeResults(result, resultFileName); } for(int i = 0; i < result.length; i++) { once = true; Protein lProtein = result[i]; String header = lProtein.getHeader().getFullHeaderWithAddenda(); String sequence = lProtein.getSequence().getSequence(); Assert.assertEquals(br.readLine(), header); Assert.assertEquals(br.readLine(), sequence); } if(!once) { fail("NO peptides AT ALL were returned when cleaving '" + p.getSequence().getSequence() + "'!"); } // Now check for the edge case where there's only one amino acid after the last cleavage position // (used to be a bug that this amino acid was never considered). e.setMiscleavages(1); result = e.cleave(new Protein(">sw|Q55645|TEST_HUMAN Test Protein for the cleave() method.", "GHIKLMVSTRPIGASDNPKLHGFVNRTGFDRA")); boolean foundIt = false; for(int i = 0; i < result.length; i++) { Protein lProtein = result[i]; if(lProtein.getSequence().getSequence().equals("TGFDRA")){ foundIt = true; break; } } if(!foundIt) { fail("The peptide 'TGFDRA' (penultimate amino acid is cleavage site, one missed cleavage allowed) was NOT returned when cleaving '" + p.getSequence().getSequence() + "'!"); } // // skip next section // for (int i = 0; i < 15; i++) { // br.readLine(); // } // Skip to the next part of the controlfile. br.readLine(); // 3 once = false; // Now Nterm position and 1 miscleavage. e.setPosition(Enzyme.NTERM); e.setMiscleavages(1); result = e.cleave(p); if (recordResult) { writeResults(result, resultFileName); } for(int i = 0; i < result.length; i++) { once = true; Protein lProtein = result[i]; String header = lProtein.getHeader().getFullHeaderWithAddenda(); String sequence = lProtein.getSequence().getSequence(); Assert.assertEquals(br.readLine(), header); Assert.assertEquals(br.readLine(), sequence); } if(!once) { fail("NO peptides AT ALL were returned when cleaving '" + p.getSequence().getSequence() + "'!"); } // Skip to the next part of the controlfile. br.readLine(); // 4 once = false; // Next, take an enzyme that does not have restricting residus. e = new RegExEnzyme("Test", "[KR]", null, "Cterm", 0); result = e.cleave(p); if (recordResult) { writeResults(result, resultFileName); } for(int i = 0; i < result.length; i++) { once = true; Protein lProtein = result[i]; String header = lProtein.getHeader().getFullHeaderWithAddenda(); String sequence = lProtein.getSequence().getSequence(); Assert.assertEquals(br.readLine(), header); Assert.assertEquals(br.readLine(), sequence); } if(!once) { fail("NO peptides AT ALL were returned when cleaving '" + p.getSequence().getSequence() + "'!"); } // Skip to the next part of the controlfile. br.readLine(); // 5 once = false; // And now take an entry that has a location set and see if the cleavage is adjusted accordingly. e = new RegExEnzyme("TestEnzyme", "[KR]", "P", "Cterm", 1); p = new Protein(">sw|Q55645 (15-45)|TEST_HUMAN Test Protein for the cleave() method.", "GHIKLMVSTRPIGASDNPKLHGFVNRTGFDA"); result = e.cleave(p); if (recordResult) { writeResults(result, resultFileName); } for(int i = 0; i < result.length; i++) { once = true; Protein lProtein = result[i]; String header = lProtein.getHeader().getFullHeaderWithAddenda(); String sequence = lProtein.getSequence().getSequence(); Assert.assertEquals(br.readLine(), header); Assert.assertEquals(br.readLine(), sequence); } if(!once) { fail("NO peptides AT ALL were returned when cleaving '" + p.getSequence().getSequence() + "'!"); } // Skip to the next part of the controlfile. br.readLine(); // 6 once = false; // Now take a C-terminally truncated sequence and see if it is cleaved correctly. e = new RegExEnzyme("TestEnzyme", "[KR]", "P", "Cterm", 1); p = new Protein(">sw|Q55645 (15-45)|TEST_HUMAN Test Protein for the cleave() method.", "GHIKLMVSTRPIGASDNPKLHGFVNRTGFDA", true, Protein.CTERMTRUNC); result = e.cleave(p); if (recordResult) { writeResults(result, resultFileName); } for(int i = 0; i < result.length; i++) { once = true; Protein lProtein = result[i]; String header = lProtein.getHeader().getFullHeaderWithAddenda(); String sequence = lProtein.getSequence().getSequence(); Assert.assertEquals(br.readLine(), header); Assert.assertEquals(br.readLine(), sequence); } if(!once) { fail("NO peptides AT ALL were returned when cleaving '" + p.getSequence().getSequence() + "'!"); } // Skip to the next part of the controlfile. br.readLine(); // 7 once = false; // Now take an N-terminally truncated sequence and see if it is cleaved correctly. e = new RegExEnzyme("TestEnzyme", "[KR]", "P", "Cterm", 1); p = new Protein(">sw|Q55645 (15-45)|TEST_HUMAN Test Protein for the cleave() method.", "GHIKLMVSTRPIGASDNPKLHGFVNRTGFDA", true, Protein.NTERMTRUNC); result = e.cleave(p); if (recordResult) { writeResults(result, resultFileName); } for(int i = 0; i < result.length; i++) { once = true; Protein lProtein = result[i]; String header = lProtein.getHeader().getFullHeaderWithAddenda(); String sequence = lProtein.getSequence().getSequence(); Assert.assertEquals(br.readLine(), header); Assert.assertEquals(br.readLine(), sequence); } if(!once) { fail("NO peptides AT ALL were returned when cleaving '" + p.getSequence().getSequence() + "'!"); } // Skip to the next part of the controlfile. br.readLine(); // 8 once = false; // Now take a translated sequence, containing an '_' (stopcodon). e = new RegExEnzyme("TestEnzyme", "[KR]", "P", "Cterm", 1); p = new Protein(">sw|Q55645 (15-45)|TEST_HUMAN Test Protein for the cleave() method.", "GHIKLMVSTRPIGASDNPKLHG_FVNRTGFDA"); result = e.cleave(p); if (recordResult) { writeResults(result, resultFileName); } for(int i = 0; i < result.length; i++) { once = true; Protein lProtein = result[i]; String header = lProtein.getHeader().getFullHeaderWithAddenda(); String sequence = lProtein.getSequence().getSequence(); Assert.assertEquals(br.readLine(), header); Assert.assertEquals(br.readLine(), sequence); } if(!once) { fail("NO peptides AT ALL were returned when cleaving '" + p.getSequence().getSequence() + "'!"); } // END of file reached. // Check this! String line; while((line = br.readLine()) != null) { if(!line.trim().equals("")) { fail("More lines in testCleave.fas then were generated by the test cleavage!"); } } br.close(); } catch(IOException ioe) { fail("IOException occurred while testing the cleave() method: '" + ioe.getMessage() + "'."); } } /** * This method test the cloning of an RegExEnzyme. * (Same tests as for Enzyme class! only slightly modified to fit RegExEnzyme) */ public void testClone() { RegExEnzyme e = new RegExEnzyme("Test", "[KR]", "P", "Cterm", 5); Enzyme clone = (Enzyme)e.clone(); Assert.assertEquals(new String(e.getCleavage()), new String(clone.getCleavage())); Assert.assertEquals(e.getMiscleavages(), clone.getMiscleavages()); Assert.assertEquals(e.getPosition(), clone.getPosition()); Assert.assertEquals(new String(e.getRestrict()), new String(clone.getRestrict())); Assert.assertEquals(e.getTitle(), clone.getTitle()); // Get a cleaved set of peptides from a sequence. final Protein p = new Protein(">Test protein.\nLENNARTMARTENS"); Protein[] controlCleave = e.cleave(p); // Get a cleaved set from the clone. Protein[] cloneCleave = clone.cleave(p); // Compare the sets. They should be identical. for(int i = 0; i < cloneCleave.length; i++) { Assert.assertEquals(controlCleave[i], cloneCleave[i]); } // Now change the clone and see if the original changes. clone.setCleavage("GH"); clone.setMiscleavages(1); clone.setPosition(Enzyme.NTERM); clone.setRestrict("L"); clone.setTitle("Clone"); // Clone should have changed. Assert.assertEquals("GH", new String(clone.getCleavage())); Assert.assertEquals(1, clone.getMiscleavages()); Assert.assertEquals(Enzyme.NTERM, clone.getPosition()); Assert.assertEquals("L", new String(clone.getRestrict())); Assert.assertEquals("Clone", clone.getTitle()); // Original should remain the same. Assert.assertEquals("[KR]", new String(e.getCleavage())); Assert.assertEquals(5, e.getMiscleavages()); Assert.assertEquals(Enzyme.CTERM, e.getPosition()); Assert.assertEquals("P", new String(e.getRestrict())); Assert.assertEquals("Test", e.getTitle()); } /** * This method test whether the isEnzymaticProduct method functions. * (Same tests as for Enzyme class! only slightly modified to fit RegExEnzyme) */ public void testIsProduct() { // C-terminal cleavage. RegExEnzyme e = new RegExEnzyme("Test", "[KR]", "P", "Cterm", 1); Protein p = new Protein(">Test Protein.\nLENNARTMARTENS"); // A non-enzymatic product by sequence and subsequently by (human readable!) indices. Assert.assertEquals(Enzyme.ENTIRELY_NOT_ENZYMATIC, e.isEnzymaticProduct(p.getSequence().getSequence(), "ENN")); Assert.assertEquals(Enzyme.ENTIRELY_NOT_ENZYMATIC, e.isEnzymaticProduct(p.getSequence().getSequence(), 2, 4)); // A half enzymatic sequence (N-terminal), also with the true N-terminus included. Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct(p.getSequence().getSequence(), "TMARTE")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct(p.getSequence().getSequence(), 7, 12)); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct(p.getSequence().getSequence(), "LEN")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct(p.getSequence().getSequence(), 1, 3)); // A half enzymatic sequence (C-terminal), also with the true C-terminus included. Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct(p.getSequence().getSequence(), "NNAR")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct(p.getSequence().getSequence(), 3, 6)); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct(p.getSequence().getSequence(), "RTENS")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct(p.getSequence().getSequence(), 10, 14)); // Check the correct behaviour when multiple occurrences take place. Assert.assertEquals(Enzyme.ENTIRELY_NOT_ENZYMATIC, e.isEnzymaticProduct("LGHJKLIGHKL", "GH")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("GHJKLIGHKL", "GH")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("FTTRGHJKLIGHKL", "GH")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("FTTGKLIGKPL", "GK")); Assert.assertEquals(Enzyme.FULLY_ENZYMATIC, e.isEnzymaticProduct("FTTRGKLIGKPL", "GK")); // Now check the correct handling of restriction locations. Assert.assertEquals(Enzyme.ENTIRELY_NOT_ENZYMATIC, e.isEnzymaticProduct("LGHRPHVVGRPLMM", "PHVVGR")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("LGHRHVVGRPLMM", "HVVGR")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("HVVGRPLMM", "HVVGR")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("LGHRPHVVGR", "PHVVGR")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("LGHRPHVVGRLMM", "PHVVGR")); Assert.assertEquals(Enzyme.FULLY_ENZYMATIC, e.isEnzymaticProduct("LGHRHVVGRLMM", "HVVGR")); // N-terminal cleavage. e = new RegExEnzyme("Test2", "[KR]", "P", "Nterm", 1); // A non-enzymatic product. Assert.assertEquals(Enzyme.ENTIRELY_NOT_ENZYMATIC, e.isEnzymaticProduct("KARVAL", "ARVA")); Assert.assertEquals(Enzyme.ENTIRELY_NOT_ENZYMATIC, e.isEnzymaticProduct("KARVAL", 2, 5)); // A half enzymatic sequence (N-terminal), also with the true N-terminus included. Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("LLKARVAL", "KARV")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("LLKARVAL", 3, 6)); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("ARVAL", "ARV")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("ARVAL", 1, 3)); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("KARVAL", "KARV")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("KARVAL", 1, 4)); // A half enzymatic sequence (C-terminal), also with the true C-terminus included. Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("LLKARVAL", "LKA")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("LLKARVAL", 2, 4)); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("LLKARVAL", "VAL")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("LLKARVAL", 6, 8)); // Check the correct behaviour when multiple occurrences take place. Assert.assertEquals(Enzyme.ENTIRELY_NOT_ENZYMATIC, e.isEnzymaticProduct("LLKARVALGHGHGLKARVRAL", "LKARV")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("GHKARVALGHKARVAL", "KARV")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("LLKARVALGHGHLKARPAL", "LKA")); Assert.assertEquals(Enzyme.FULLY_ENZYMATIC, e.isEnzymaticProduct("LLKARVALGHGHLKARPAL", "KA")); // Now check the correct handling of restriction locations. Assert.assertEquals(Enzyme.ENTIRELY_NOT_ENZYMATIC, e.isEnzymaticProduct("LGHRPHVVGRPLMM", "RPHVVG")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("LGHRHVVGRPLMM", "RHVVG")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("HVVGRPLMM", "HVVG")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("LGHRPHVVGR", "RPHVVG")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("LGHRPHVVGRLMM", "RPHVVG")); Assert.assertEquals(Enzyme.FULLY_ENZYMATIC, e.isEnzymaticProduct("LGHRHVVGRLMM", "RHVVG")); // Test exception handling. try { e.isEnzymaticProduct("LENNARTMARTENS", "FILIBERKE"); fail("No IllegalArgumentException thrown when confronting an Enzyme with subsequence 'FILIBERKE' in 'LENNARTMARTENS' for 'isEnzymaticProduct(String, String)'!"); } catch(IllegalArgumentException iae) { // Perfect. } try { e.isEnzymaticProduct("LENNARTMARTENS", "FILIBERKE"); fail("No IllegalArgumentException thrown when confronting an Enzyme with subsequence 'FILIBERKE' in 'LENNARTMARTENS' for 'isEnzymaticProduct(String, String)'!"); } catch(IllegalArgumentException iae) { // Perfect. } try { e.isEnzymaticProduct("LENNARTMARTENS", -1, 12); fail("No IllegalArgumentException thrown when confronting an Enzyme with subsequence indices (-1, 12) and 'LENNARTMARTENS' for 'isEnzymaticProduct(String, int, int)'!"); } catch(IllegalArgumentException iae) { // Perfect. } try { e.isEnzymaticProduct("LENNARTMARTENS", 1, -1); fail("No IllegalArgumentException thrown when confronting an Enzyme with subsequence indices (1, -1) and 'LENNARTMARTENS' for 'isEnzymaticProduct(String, int, int)'!"); } catch(IllegalArgumentException iae) { // Perfect. } try { e.isEnzymaticProduct("LENNARTMARTENS", 3, 2); fail("No IllegalArgumentException thrown when confronting an Enzyme with subsequence indices (3, 2) and 'LENNARTMARTENS' for 'isEnzymaticProduct(String, int, int)'!"); } catch(IllegalArgumentException iae) { // Perfect. } try { e.isEnzymaticProduct("LENNARTMARTENS", 6, 15); fail("No IllegalArgumentException thrown when confronting an Enzyme with subsequence indices (6, 15) and 'LENNARTMARTENS' (last char at 14) for 'isEnzymaticProduct(String, int, int)'!"); } catch(IllegalArgumentException iae) { // Perfect. } try { e.isEnzymaticProduct("LENNARTMARTENS", 6, 129); fail("No IllegalArgumentException thrown when confronting an Enzyme with subsequence indices (6, 129) and 'LENNARTMARTENS' (last char at 14) for 'isEnzymaticProduct(String, int, int)'!"); } catch(IllegalArgumentException iae) { // Perfect. } } /** * This method test a simple Caspase-like cleaving, since it is a real, * multi-residue matching regular expression. */ public void testCaspaseCleaving() { // C-terminal cleavage. final String title1 = "regexCaspase"; final String cleavage1 = "D..D"; final char[] cv1 = cleavage1.toCharArray(); final String pos1 = "Cterm"; final String pos2 = "nteRm"; RegExEnzyme e = new RegExEnzyme(title1, cleavage1, null, pos1); e.setMiscleavages(0); Assert.assertEquals(title1, e.getTitle()); Assert.assertEquals(new String(cv1), new String(e.getCleavage())); Assert.assertEquals(RegExEnzyme.CTERM, e.getPosition()); Protein p = new Protein(">Test Protein.\nGHLKFDMTDNRSGHLKFDMTDNRSGHLKFDMTDNRS"); Protein[] products = e.cleave(p); Assert.assertEquals(4, products.length); Assert.assertEquals("GHLKFDMTD", products[0].getSequence().getSequence()); Assert.assertEquals("NRSGHLKFDMTD", products[1].getSequence().getSequence()); Assert.assertEquals("NRSGHLKFDMTD", products[2].getSequence().getSequence()); Assert.assertEquals("NRS", products[3].getSequence().getSequence()); Assert.assertEquals(1, products[0].getHeader().getStartLocation()); Assert.assertEquals(9, products[0].getHeader().getEndLocation()); Assert.assertEquals(10, products[1].getHeader().getStartLocation()); Assert.assertEquals(21, products[1].getHeader().getEndLocation()); Assert.assertEquals(22, products[2].getHeader().getStartLocation()); Assert.assertEquals(33, products[2].getHeader().getEndLocation()); Assert.assertEquals(34, products[3].getHeader().getStartLocation()); Assert.assertEquals(36, products[3].getHeader().getEndLocation()); Assert.assertEquals(Enzyme.FULLY_ENZYMATIC, e.isEnzymaticProduct("GHLKFDMTDNRSGHLKFDMTDNRSGHLKFDMTDNRS", "NRSGHLKFDMTD")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("GHLKFDMTDNRSGHLKFDMTDNRSGHLKFDMTDNRS", "NRSGHLKF")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("GHLKFDMTDNRSGHLKFDMTDNRSGHLKFDMTDNRS", "LKFDMTD")); Assert.assertEquals(Enzyme.ENTIRELY_NOT_ENZYMATIC, e.isEnzymaticProduct("GHLKFDMTDNRSGHLKFDMTDNRSGHLKFDMTDNRS", "LKFD")); // N-terminal cleavage. e = new RegExEnzyme(title1, cleavage1, null, pos2); e.setMiscleavages(0); Assert.assertEquals(title1, e.getTitle()); Assert.assertEquals(new String(cv1), new String(e.getCleavage())); Assert.assertEquals(RegExEnzyme.NTERM, e.getPosition()); p = new Protein(">Test Protein.\nGHLKFDMTDNRSGHLKFDMTDNRSGHLKFDMTDNRS"); products = e.cleave(p); Assert.assertEquals(4, products.length); Assert.assertEquals("GHLKFDMT", products[0].getSequence().getSequence()); Assert.assertEquals("DNRSGHLKFDMT", products[1].getSequence().getSequence()); Assert.assertEquals("DNRSGHLKFDMT", products[2].getSequence().getSequence()); Assert.assertEquals("DNRS", products[3].getSequence().getSequence()); Assert.assertEquals(1, products[0].getHeader().getStartLocation()); Assert.assertEquals(8, products[0].getHeader().getEndLocation()); Assert.assertEquals(9, products[1].getHeader().getStartLocation()); Assert.assertEquals(20, products[1].getHeader().getEndLocation()); Assert.assertEquals(21, products[2].getHeader().getStartLocation()); Assert.assertEquals(32, products[2].getHeader().getEndLocation()); Assert.assertEquals(33, products[3].getHeader().getStartLocation()); Assert.assertEquals(36, products[3].getHeader().getEndLocation()); Assert.assertEquals(Enzyme.FULLY_ENZYMATIC, e.isEnzymaticProduct("GHLKFDMTDNRSGHLKFDMTDNRSGHLKFDMTDNRS", "DNRSGHLKFDMT")); Assert.assertEquals(Enzyme.N_TERM_ENZYMATIC, e.isEnzymaticProduct("GHLKFDMTDNRSGHLKFDMTDNRSGHLKFDMTDNRS", "DNRSGHLKF")); Assert.assertEquals(Enzyme.C_TERM_ENZYMATIC, e.isEnzymaticProduct("GHLKFDMTDNRSGHLKFDMTDNRSGHLKFDMTDNRS", "LKFDMT")); Assert.assertEquals(Enzyme.ENTIRELY_NOT_ENZYMATIC, e.isEnzymaticProduct("GHLKFDMTDNRSGHLKFDMTDNRSGHLKFDMTDNRS", "LKFD")); } private void writeResults(Protein[] proteins, String filename) throws IOException { BufferedWriter writer = new BufferedWriter(new FileWriter(filename, true)); for (int i = 0; i < proteins.length; i++) { Protein protein = proteins[i]; String header = protein.getHeader().getFullHeaderWithAddenda(); String sequence = protein.getSequence().getSequence(); writer.write(header); writer.newLine(); writer.write(sequence); writer.newLine(); } writer.newLine(); writer.flush(); writer.close(); } }