/* * BioJava development code * * This code may be freely distributed and modified under the * terms of the GNU Lesser General Public Licence. This should * be distributed with the code. If you do not have a copy, * see: * * http://www.gnu.org/copyleft/lesser.html * * Copyright for this code is held jointly by the individual * authors. These should be listed in @author doc comments. * * For more information on the BioJava project and its aims, * or to join the biojava-l mailing list, visit the home page * at: * * http://www.biojava.org/ * */ package demo; import org.biojava.nbio.core.sequence.io.util.IOUtils; import org.biojava.nbio.ws.alignment.qblast.BlastProgramEnum; import org.biojava.nbio.ws.alignment.qblast.NCBIQBlastAlignmentProperties; import org.biojava.nbio.ws.alignment.qblast.NCBIQBlastOutputProperties; import org.biojava.nbio.ws.alignment.qblast.NCBIQBlastService; import java.io.*; import static org.biojava.nbio.ws.alignment.qblast.BlastAlignmentParameterEnum.ENTREZ_QUERY; /** * A simple demo showing {@link NCBIQBlastService} usage * * @author Gediminas Rimsa */ public class NCBIQBlastServiceDemo { private static final String BLAST_OUTPUT_FILE = "blastOutput.xml"; private static final String SEQUENCE = "MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS"; public static void main(String[] args) { NCBIQBlastService service = null; if (args.length == 1) { service = new NCBIQBlastService(args[0]); } else { service = new NCBIQBlastService(); } // set alignment options NCBIQBlastAlignmentProperties props = new NCBIQBlastAlignmentProperties(); props.setBlastProgram(BlastProgramEnum.blastp); props.setBlastDatabase("swissprot"); props.setAlignmentOption(ENTREZ_QUERY, "\"serum albumin\"[Protein name] AND mammals[Organism]"); // set output options NCBIQBlastOutputProperties outputProps = new NCBIQBlastOutputProperties(); // Example of two possible ways of setting output options (in this case, it was already set by constructor) // outputProps.setAlignmentNumber(100); // outputProps.setOutputOption(BlastOutputParameterEnum.ALIGNMENTS, "100"); String rid = null; FileWriter writer = null; BufferedReader reader = null; try { // send blast request and save request id rid = service.sendAlignmentRequest(SEQUENCE, props); while (!service.isReady(rid)) { System.out.println("Waiting for results. Sleeping for 5 seconds"); Thread.sleep(5000); } // read results when they are ready InputStream in = service.getAlignmentResults(rid, outputProps); reader = new BufferedReader(new InputStreamReader(in)); File f = new File(BLAST_OUTPUT_FILE); System.out.println("Saving query results in file " + f.getAbsolutePath()); writer = new FileWriter(f); String line; while ((line = reader.readLine()) != null) { writer.write(line + System.getProperty("line.separator")); } } catch (Exception e) { System.out.println(e.getMessage()); e.printStackTrace(); } finally { IOUtils.close(writer); IOUtils.close(reader); service.sendDeleteRequest(rid); } } }