/*
 *                    BioJava development code
 *
 * This code may be freely distributed and modified under the
 * terms of the GNU Lesser General Public Licence.  This should
 * be distributed with the code.  If you do not have a copy,
 * see:
 *
 *      http://www.gnu.org/copyleft/lesser.html
 *
 * Copyright for this code is held jointly by the individual
 * authors.  These should be listed in @author doc comments.
 *
 * For more information on the BioJava project and its aims,
 * or to join the biojava-l mailing list, visit the home page
 * at:
 *
 *      http://www.biojava.org/
 *
 */
package org.biojava.nbio.alignment.io;

//import java.io.BufferedReader;
//import java.io.IOException;

import junit.framework.TestCase;
import org.biojava.nbio.core.sequence.template.AbstractSequence;

import java.io.InputStream;
import java.util.zip.GZIPInputStream;

//import java.io.InputStreamReader;

public class TestStockholmParser extends TestCase {

//	public void testStockholmParser(){
//
//		InputStream inStream = this.getClass().getResourceAsStream("/test.sth");
//
//		StockholmFileParser fileParser = new StockholmFileParser();
//
//		BufferedReader buf;
//		if (inStream == null) {
//			fail("input stream is null!");
//		}
//
//		buf = new BufferedReader(new InputStreamReader(inStream));
//
//		try {
//			StockholmStructure data = fileParser.parseFile(buf);
//			System.out.println(data);
//
//			assertTrue(data.getBioSequences().size()==5);
//
//			AbstractSequence<?> seq = data.getBioSequences().get(0);
//			assertTrue(seq != null );
//
//			assertEquals(seq.getSequenceAsString(),"MTCRAQLIAVPRASSLAEAIACAQKMRVSRVPVYERS");
//
//		} catch (Exception e) {
//
//			e.printStackTrace();
//			fail(e.getMessage());
//		}
//
//
//	}

	public void testPiwi(){
		try {
			InputStream inStream = new GZIPInputStream(this.getClass().getResourceAsStream("/piwi.sth.gz"));

			assertNotNull(inStream);

			StockholmFileParser fileParser = new StockholmFileParser();

			StockholmStructure data = fileParser.parse(inStream);

			assertTrue("Did not get enough sequences!", data.getBioSequences(false).size()==20);

			AbstractSequence<?> seq = data.getBioSequences(false).get(0);
			assertTrue(seq != null );

			assertTrue(seq.getSequenceAsString().length() > 20);

		} catch (Exception e) {

			e.printStackTrace();
			fail(e.getMessage());
		}


	}

}